TCP11L1 polyclonal antibody
  • TCP11L1 polyclonal antibody

TCP11L1 polyclonal antibody

Ref: AB-PAB20318
TCP11L1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TCP11L1.
Información adicional
Size 100 uL
Gene Name TCP11L1
Gene Alias FLJ11336|FLJ11386|dJ85M6.3
Gene Description t-complex 11 (mouse)-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq SENLDKSNVNEAGKSKSNDSEEGLEDAVEGADEALQKAIKSDSSSPQRVQRPHSSPPRFVTVEELLETARGVTNMALAHEIVVNGDFQIKPVELPENSLKKRVKEIVHKAFWDCLSVQLSEDPPAYDHAIKLVGEIKET
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TCP11L1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55346
Iso type IgG

Enviar uma mensagem


TCP11L1 polyclonal antibody

TCP11L1 polyclonal antibody