RNASE7 polyclonal antibody
  • RNASE7 polyclonal antibody

RNASE7 polyclonal antibody

Ref: AB-PAB20313
RNASE7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RNASE7.
Información adicional
Size 100 uL
Gene Name RNASE7
Gene Alias MGC133220
Gene Description ribonuclease, RNase A family, 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq KGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGPVSLTMCKLTSGKYPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRV
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RNASE7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84659
Iso type IgG

Enviar uma mensagem


RNASE7 polyclonal antibody

RNASE7 polyclonal antibody