CASP8 polyclonal antibody
  • CASP8 polyclonal antibody

CASP8 polyclonal antibody

Ref: AB-PAB20312
CASP8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CASP8.
Información adicional
Size 100 uL
Gene Name CASP8
Gene Alias ALPS2B|CAP4|FLICE|FLJ17672|MACH|MCH5|MGC78473
Gene Description caspase 8, apoptosis-related cysteine peptidase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq LGEGKLDILKRVCAQINKSLLKIINDYEEFSKGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICC
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CASP8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 841
Iso type IgG

Enviar uma mensagem


CASP8 polyclonal antibody

CASP8 polyclonal antibody