SEC16A polyclonal antibody
  • SEC16A polyclonal antibody

SEC16A polyclonal antibody

Ref: AB-PAB20311
SEC16A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SEC16A.
Información adicional
Size 100 uL
Gene Name SEC16A
Gene Alias FLJ26737|KIAA0310|RP11-413M3.10|SEC16L|p250
Gene Description SEC16 homolog A (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGLANPEPAPEPKAPGDLPAAGGPPSGAMPFYNPAQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SEC16A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9919
Iso type IgG

Enviar uma mensagem


SEC16A polyclonal antibody

SEC16A polyclonal antibody