DIAPH2 polyclonal antibody
  • DIAPH2 polyclonal antibody

DIAPH2 polyclonal antibody

Ref: AB-PAB20307
DIAPH2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DIAPH2.
Información adicional
Size 100 uL
Gene Name DIAPH2
Gene Alias DIA|DIA2|DRF2|FLJ11167|POF|POF2
Gene Description diaphanous homolog 2 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq GGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVVQYISAT
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DIAPH2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1730
Iso type IgG

Enviar uma mensagem


DIAPH2 polyclonal antibody

DIAPH2 polyclonal antibody