KEAP1 polyclonal antibody
  • KEAP1 polyclonal antibody

KEAP1 polyclonal antibody

Ref: AB-PAB20302
KEAP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KEAP1.
Información adicional
Size 100 uL
Gene Name KEAP1
Gene Alias INrf2|KIAA0132|KLHL19|MGC10630|MGC1114|MGC20887|MGC4407|MGC9454
Gene Description kelch-like ECH-associated protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MYASTECKAEVTPSQHGNRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVM
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KEAP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9817
Iso type IgG

Enviar uma mensagem


KEAP1 polyclonal antibody

KEAP1 polyclonal antibody