ZNF701 polyclonal antibody
  • ZNF701 polyclonal antibody

ZNF701 polyclonal antibody

Ref: AB-PAB20299
ZNF701 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF701.
Información adicional
Size 100 uL
Gene Name ZNF701
Gene Alias FLJ10891
Gene Description zinc finger protein 701
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq QIHASHHIGDTCFQEIEKDIHDFVFQWQENETNGHEALMTKTKKLMSSTERHDQRHAGNKPIKNELGSSFHSHLPEVHIFHPEGKIGNQVEKAINDAFSVSASQRISCRPKTRISNKYRNNFLQSSLLTQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF701.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55762
Iso type IgG

Enviar uma mensagem


ZNF701 polyclonal antibody

ZNF701 polyclonal antibody