SH2B3 polyclonal antibody
  • SH2B3 polyclonal antibody

SH2B3 polyclonal antibody

Ref: AB-PAB20298
SH2B3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SH2B3.
Información adicional
Size 100 uL
Gene Name SH2B3
Gene Alias CELIAC13|LNK
Gene Description SH2B adaptor protein 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq FDPPKSSRPKLQAACSSIQEVRRCTRLEMPDNLYTFVLKVKDRTDIIFEVGDEQQLNSWMAELSECTGRGLESTEAEMHIPSALEPSTSSSPRGSTDSLNQGASPGGLLDPACQKTDHFLSCYPWFH
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SH2B3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10019
Iso type IgG

Enviar uma mensagem


SH2B3 polyclonal antibody

SH2B3 polyclonal antibody