LANCL3 polyclonal antibody
  • LANCL3 polyclonal antibody

LANCL3 polyclonal antibody

Ref: AB-PAB20296
LANCL3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LANCL3.
Información adicional
Size 100 uL
Gene Name LANCL3
Gene Alias FLJ42925
Gene Description LanC lantibiotic synthetase component C-like 3 (bacterial)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VAYMLYHVSQSPLFATARERYLRSAKRLIDACARAEEWGEPDADTRAAFLLGGAGVYAVATLVYHALGRSDYVQPLGKFRALCAVC
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LANCL3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 347404
Iso type IgG

Enviar uma mensagem


LANCL3 polyclonal antibody

LANCL3 polyclonal antibody