DSG2 polyclonal antibody
  • DSG2 polyclonal antibody

DSG2 polyclonal antibody

Ref: AB-PAB20290
DSG2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DSG2.
Información adicional
Size 100 uL
Gene Name DSG2
Gene Alias ARVC10|ARVD10|CDHF5|HDGC|MGC117034|MGC117036|MGC117037
Gene Description desmoglein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq APPEDKVVPSFLPVDQGGSLVGRNGVGGMAKEATMKGSSSASIVKGQHEMSEMDGRWEEHRSLLSGRATQFTGATGAIMTTETTKTARATGASRDMAGAQAAAVALNEEFLRNYFTDKAASYTEEDENHTAKDCLLVYSQEETESLNAS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DSG2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1829
Iso type IgG

Enviar uma mensagem


DSG2 polyclonal antibody

DSG2 polyclonal antibody