SCN7A polyclonal antibody
  • SCN7A polyclonal antibody

SCN7A polyclonal antibody

Ref: AB-PAB20287
SCN7A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SCN7A.
Información adicional
Size 100 uL
Gene Name SCN7A
Gene Alias SCN6A
Gene Description sodium channel, voltage-gated, type VII, alpha
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LLKILCKTQNVPKDTMDHVNEVYVKEDISDHTLSELSNTQDFLKDKEKSSGTEKNATENESQSLIPSPSVSETVPIASGESDIENLDNKEIQSKSGDGGSKEK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SCN7A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6332
Iso type IgG

Enviar uma mensagem


SCN7A polyclonal antibody

SCN7A polyclonal antibody