ARPC1B polyclonal antibody
  • ARPC1B polyclonal antibody

ARPC1B polyclonal antibody

Ref: AB-PAB20284
ARPC1B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARPC1B.
Información adicional
Size 100 uL
Gene Name ARPC1B
Gene Alias ARC41|p40-ARC|p41-ARC
Gene Description actin related protein 2/3 complex, subunit 1B, 41kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq TVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ARPC1B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10095
Iso type IgG

Enviar uma mensagem


ARPC1B polyclonal antibody

ARPC1B polyclonal antibody