CT83 polyclonal antibody
  • CT83 polyclonal antibody

CT83 polyclonal antibody

Ref: AB-PAB20279
CT83 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CT83.
Información adicional
Size 100 uL
Gene Name CT83
Gene Alias CXorf61|KK-LC-1|KKLC1
Gene Description cancer/testis antigen 83
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CT83.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 203413
Iso type IgG

Enviar uma mensagem


CT83 polyclonal antibody

CT83 polyclonal antibody