CPN2 polyclonal antibody
  • CPN2 polyclonal antibody

CPN2 polyclonal antibody

Ref: AB-PAB20278
CPN2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CPN2.
Información adicional
Size 100 uL
Gene Name CPN2
Gene Alias ACBP
Gene Description carboxypeptidase N, polypeptide 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FDTNYNLFNLALHGNPWQCDCHLAYLFNWLQQYTDRLLNIQTYCAGPAYLKGQVVPALNEKQLVCPVTRDHLGFQVTWPDESKAGGSWDLAVQERAARSQCTYSNPEGTVVLACDQAQCRWLNVQLSPWQGSLGLQYNASQEW
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CPN2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1370
Iso type IgG

Enviar uma mensagem


CPN2 polyclonal antibody

CPN2 polyclonal antibody