PLEKHA2 polyclonal antibody
  • PLEKHA2 polyclonal antibody

PLEKHA2 polyclonal antibody

Ref: AB-PAB20275
PLEKHA2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PLEKHA2.
Información adicional
Size 100 uL
Gene Name PLEKHA2
Gene Alias FLJ25921|TAPP2
Gene Description pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GAGAVGALQLTYISKVSIATPKQKPKTPFCFVINALSQRYFLQANDQKDMKDWVEALNQASKITVPKGGGLPMTTEVLKSLAAPPALEKKPQVAYKTEIIGGVVVHTPISQNGGDGQEGSEPGSHTILRRSQSYIPTS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PLEKHA2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 59339
Iso type IgG

Enviar uma mensagem


PLEKHA2 polyclonal antibody

PLEKHA2 polyclonal antibody