ARSD polyclonal antibody
  • ARSD polyclonal antibody

ARSD polyclonal antibody

Ref: AB-PAB20273
ARSD polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARSD.
Información adicional
Size 100 uL
Gene Name ARSD
Gene Alias -
Gene Description arylsulfatase D
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq QGAEARSAHEFLFHYCGQHLHAARWHQKDSGSVWKVHYTTPQFHPEGAGACYGRGVCPCSGEGVTHHRPPLLFDLSRDPSEARPLTPDSEPLYHAVIARVGAAVSEHRQTLSPVPQQFSMSNILWKPWLQPCCGHFPFCSCHED
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ARSD.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 414
Iso type IgG

Enviar uma mensagem


ARSD polyclonal antibody

ARSD polyclonal antibody