KIF5A polyclonal antibody
  • KIF5A polyclonal antibody

KIF5A polyclonal antibody

Ref: AB-PAB20271
KIF5A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIF5A.
Información adicional
Size 100 uL
Gene Name KIF5A
Gene Alias D12S1889|MY050|NKHC|SPG10
Gene Description kinesin family member 5A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq AQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIF5A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3798
Iso type IgG

Enviar uma mensagem


KIF5A polyclonal antibody

KIF5A polyclonal antibody