GIT1 polyclonal antibody
  • GIT1 polyclonal antibody

GIT1 polyclonal antibody

Ref: AB-PAB20268
GIT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GIT1.
Información adicional
Size 100 uL
Gene Name GIT1
Gene Alias -
Gene Description G protein-coupled receptor kinase interacting ArfGAP 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq DLDDQHDYDSVASDEDTDQEPLRSTGATRSNRARSMDSSDLSDGAVTLQEYLELKKALATSEAKVQQLMKVSSSLSDELRRLQREIHKLQAENLQLRQPPGPVPTPPLPSERAEHTPMAPGGSTHRRDRQAFSMYEPGSAL
Form Liquid
Recomended Dilution Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GIT1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 28964
Iso type IgG

Enviar uma mensagem


GIT1 polyclonal antibody

GIT1 polyclonal antibody