WASF1 polyclonal antibody
  • WASF1 polyclonal antibody

WASF1 polyclonal antibody

Ref: AB-PAB20262
WASF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant WASF1.
Información adicional
Size 100 uL
Gene Name WASF1
Gene Alias FLJ31482|KIAA0269|SCAR1|WAVE|WAVE1
Gene Description WAS protein family, member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PRAPHDRRREWQKLAQGPELAEDDANLLHKHIEVANGPASHFETRPQTYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPPPPPMHGAGDAKPIPTCISSATGLIENRPQSPATGRTPVFVSPTP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human WASF1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8936
Iso type IgG

Enviar uma mensagem


WASF1 polyclonal antibody

WASF1 polyclonal antibody