ZNF222 polyclonal antibody
  • ZNF222 polyclonal antibody

ZNF222 polyclonal antibody

Ref: AB-PAB20258
ZNF222 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF222.
Información adicional
Size 100 uL
Gene Name ZNF222
Gene Alias -
Gene Description zinc finger protein 222
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq AQRKLYRDVMLENFRNLLSVGGKIQTEMETFPEAGTHEEFSCKQIWEQIASDLTRSQDTTISNSQLFEQDDNPSQIKARLSTVHTREKPFQGENCKQFFSDVSFFDLPQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF222.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7673
Iso type IgG

Enviar uma mensagem


ZNF222 polyclonal antibody

ZNF222 polyclonal antibody