ITPR3 polyclonal antibody
  • ITPR3 polyclonal antibody

ITPR3 polyclonal antibody

Ref: AB-PAB20248
ITPR3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ITPR3.
Información adicional
Size 100 uL
Gene Name ITPR3
Gene Alias FLJ36205|IP3R|IP3R3
Gene Description inositol 1,4,5-triphosphate receptor, type 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ITSTKNEKIFQESIGLAIHLLDGGNTEIQKSFHNLMMSDKKSERFFKVLHDRMKRAQQETKSTVAVNMNDLGSQPHEDREPVDPTTKGRVASFSIPGSSSRYSLGPSLRRGHEVSERVQSSEMGTSVLIMQPILRFLQLLCENHNRD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ITPR3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3710
Iso type IgG

Enviar uma mensagem


ITPR3 polyclonal antibody

ITPR3 polyclonal antibody