RNGTT polyclonal antibody
  • RNGTT polyclonal antibody

RNGTT polyclonal antibody

Ref: AB-PAB20242
RNGTT polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RNGTT.
Información adicional
Size 100 uL
Gene Name RNGTT
Gene Alias CAP1A|DKFZp686J2031|HCE|HCE1|hCAP
Gene Description RNA guanylyltransferase and 5'-phosphatase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq IKLLDLKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDRVNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEP
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RNGTT.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8732
Iso type IgG

Enviar uma mensagem


RNGTT polyclonal antibody

RNGTT polyclonal antibody