TRIOBP polyclonal antibody
  • TRIOBP polyclonal antibody

TRIOBP polyclonal antibody

Ref: AB-PAB20241
TRIOBP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TRIOBP.
Información adicional
Size 100 uL
Gene Name TRIOBP
Gene Alias DFNB28|FLJ39315|HRIHFB2122|KIAA1662|TARA|dJ37E16.4
Gene Description TRIO and F-actin binding protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EIGALMRQAEEREHTLRRCQQEGQELLRHNQELHGRLSEEIDQLRGFIASQGMGNGCGRSNERSSCELEVLLRVKENELQYLKKEVQCLRDELQMMQKDKRFTSGKYQDVYVELSHIKTRSEREIEQLKEHLRL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TRIOBP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 11078
Iso type IgG

Enviar uma mensagem


TRIOBP polyclonal antibody

TRIOBP polyclonal antibody