PNPLA4 polyclonal antibody
  • PNPLA4 polyclonal antibody

PNPLA4 polyclonal antibody

Ref: AB-PAB20237
PNPLA4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PNPLA4.
Información adicional
Size 100 uL
Gene Name PNPLA4
Gene Alias DXS1283E|GS2|IPLA2-ETA
Gene Description patatin-like phospholipase domain containing 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QFTYKFAEEIRRQSFGAVTPGYDFMARLRSGMESILPPSAHELAQNRLHVSITNAKTRENHLVSTFSSREDLIKVLLASSFVPIYAGLKLVEYKGQKWVDGGLTNALPILPVGRTVTISPFSGRLDISPQDKGQLD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PNPLA4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8228
Iso type IgG

Enviar uma mensagem


PNPLA4 polyclonal antibody

PNPLA4 polyclonal antibody