ANKLE2 polyclonal antibody
  • ANKLE2 polyclonal antibody

ANKLE2 polyclonal antibody

Ref: AB-PAB20228
ANKLE2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKLE2.
Información adicional
Size 100 uL
Gene Name ANKLE2
Gene Alias FLJ22280|FLJ36132|KIAA0692|LEMD7
Gene Description ankyrin repeat and LEM domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SETVNKERANSYKNPRTQDLTAKLRKAVEKGEEDTFSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMHVAAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFACKFGNADVVNVLSSH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKLE2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23141
Iso type IgG

Enviar uma mensagem


ANKLE2 polyclonal antibody

ANKLE2 polyclonal antibody