BUB3 polyclonal antibody
  • BUB3 polyclonal antibody

BUB3 polyclonal antibody

Ref: AB-PAB20227
BUB3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BUB3.
Información adicional
Size 100 uL
Gene Name BUB3
Gene Alias BUB3L|hBUB3
Gene Description budding uninhibited by benzimidazoles 3 homolog (yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq YQTRCIRAFPNKQGYVLSSIEGRVAVEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDAETKPKSP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BUB3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9184
Iso type IgG

Enviar uma mensagem


BUB3 polyclonal antibody

BUB3 polyclonal antibody