SETD3 polyclonal antibody
  • SETD3 polyclonal antibody

SETD3 polyclonal antibody

Ref: AB-PAB20226
SETD3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SETD3.
Información adicional
Size 100 uL
Gene Name SETD3
Gene Alias C14orf154|DKFZp761E1415|FLJ23027|MGC87236
Gene Description SET domain containing 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq ERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQSTQAIHDVFSQYKNTARQYAYFYKVIQTHPHANKLPLKDSFTYEDYRWAVSSVMTRQNQIPTEDGSR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SETD3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84193
Iso type IgG

Enviar uma mensagem


SETD3 polyclonal antibody

SETD3 polyclonal antibody