PARP12 polyclonal antibody
  • PARP12 polyclonal antibody

PARP12 polyclonal antibody

Ref: AB-PAB20225
PARP12 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PARP12.
Información adicional
Size 100 uL
Gene Name PARP12
Gene Alias FLJ22693|MST109|MSTP109|PARP-12|ZC3H1|ZC3HDC1
Gene Description poly (ADP-ribose) polymerase family, member 12
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AATLKFQAGKHNYELDFKAFVQKNLVYGTTKKVCRRPKYVSPQDVTTMQTCNTKFPGPKSIPDYWDSSALPDPGFQKITLSSSSEEYQKVWNLFNRTLPFYFVQKIERVQNLALWEVYQWQKGQMQKQNGG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PARP12.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64761
Iso type IgG

Enviar uma mensagem


PARP12 polyclonal antibody

PARP12 polyclonal antibody