SCFD1 polyclonal antibody
  • SCFD1 polyclonal antibody

SCFD1 polyclonal antibody

Ref: AB-PAB20223
SCFD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SCFD1.
Información adicional
Size 100 uL
Gene Name SCFD1
Gene Alias C14orf163|KIAA0917|RA410|SLY1|STXBP1L2
Gene Description sec1 family domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AALAASAVTQVAKVFDQYLNFITLEDDMFVLCNQNKELVSYRAINRPDITDTEMETVMDTIVDSLFCFFVTLGAVPIIRCSRGTAAEMVAVKLDKKLRENLRDARNSLFTGDTLGAGQFSFQRPL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SCFD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23256
Iso type IgG

Enviar uma mensagem


SCFD1 polyclonal antibody

SCFD1 polyclonal antibody