C14orf101 polyclonal antibody
  • C14orf101 polyclonal antibody

C14orf101 polyclonal antibody

Ref: AB-PAB20218
C14orf101 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C14orf101.
Información adicional
Size 100 uL
Gene Name C14orf101
Gene Alias FLJ20392
Gene Description chromosome 14 open reading frame 101
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SSYLNHARWTWGDQTTLQGFLTHFLREEYGTFSLAKSEIGSSMSEILLSQVTNMRTELSFNIQALAVCANICLATKDRQNP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C14orf101.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54916
Iso type IgG

Enviar uma mensagem


C14orf101 polyclonal antibody

C14orf101 polyclonal antibody