RAB5C polyclonal antibody
  • RAB5C polyclonal antibody

RAB5C polyclonal antibody

Ref: AB-PAB20210
RAB5C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RAB5C.
Información adicional
Size 100 uL
Gene Name RAB5C
Gene Alias MGC117217|MGC138857|RAB5CL|RABL
Gene Description RAB5C, member RAS oncogene family
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq NSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RAB5C.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5878
Iso type IgG

Enviar uma mensagem


RAB5C polyclonal antibody

RAB5C polyclonal antibody