PITPNM2 polyclonal antibody
  • PITPNM2 polyclonal antibody

PITPNM2 polyclonal antibody

Ref: AB-PAB20209
PITPNM2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PITPNM2.
Información adicional
Size 100 uL
Gene Name PITPNM2
Gene Alias KIAA1457|NIR3|RDGB2|RDGBA2
Gene Description phosphatidylinositol transfer protein, membrane-associated 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PKDITKWSSNDLMDKIESPEPEDTQDGLYRQGAPEFRVASSVEQLNIIEDEVSQPLAAPPSKIHVLLLVLHGGTILDTGAGDPSSKKGDANTIANVFDTVMRVHYPSALGRLAIRLVPCPPVCSDAFALVSN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PITPNM2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57605
Iso type IgG

Enviar uma mensagem


PITPNM2 polyclonal antibody

PITPNM2 polyclonal antibody