RPL12 polyclonal antibody
  • RPL12 polyclonal antibody

RPL12 polyclonal antibody

Ref: AB-PAB20207
RPL12 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RPL12.
Información adicional
Size 100 uL
Gene Name RPL12
Gene Alias -
Gene Description ribosomal protein L12
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RPL12.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6136
Iso type IgG

Enviar uma mensagem


RPL12 polyclonal antibody

RPL12 polyclonal antibody