SPTB polyclonal antibody
  • SPTB polyclonal antibody

SPTB polyclonal antibody

Ref: AB-PAB20204
SPTB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPTB.
Información adicional
Size 100 uL
Gene Name SPTB
Gene Alias HSpTB1
Gene Description spectrin, beta, erythrocytic
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq TSVLILQRKHKAFEDELRGLDAHLEQIFQEAHGMVARKQFGHPQIEARIKEVSAQWDQLKDLAAFCKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRALGKKHKDFLEELEESRGVMEHLEQQAQGFPEEF
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPTB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6710
Iso type IgG

Enviar uma mensagem


SPTB polyclonal antibody

SPTB polyclonal antibody