C14orf135 polyclonal antibody
  • C14orf135 polyclonal antibody

C14orf135 polyclonal antibody

Ref: AB-PAB20202
C14orf135 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C14orf135.
Información adicional
Size 100 uL
Gene Name C14orf135
Gene Alias FBP2|FLJ12799|FLJ38170
Gene Description chromosome 14 open reading frame 135
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NKSTTVERILTTDILAEEDEHEFTSCTGAETVKFLIPGKKYV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C14orf135.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64430
Iso type IgG

Enviar uma mensagem


C14orf135 polyclonal antibody

C14orf135 polyclonal antibody