RPL3 polyclonal antibody
  • RPL3 polyclonal antibody

RPL3 polyclonal antibody

Ref: AB-PAB20200
RPL3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RPL3.
Información adicional
Size 100 uL
Gene Name RPL3
Gene Alias MGC104284|TARBP-B
Gene Description ribosomal protein L3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq EDGKKQLEKDFSSMKKYCQVIRVIAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RPL3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6122
Iso type IgG

Enviar uma mensagem


RPL3 polyclonal antibody

RPL3 polyclonal antibody