CXorf27 polyclonal antibody
  • CXorf27 polyclonal antibody

CXorf27 polyclonal antibody

Ref: AB-PAB20197
CXorf27 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CXorf27.
Información adicional
Size 100 uL
Gene Name CXorf27
Gene Alias 1700054O13Rik|HIP17|HYPM
Gene Description chromosome X open reading frame 27
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NPANIMSEKKNCKNSSTNNNQTQDPSRNELQVPRSFVDRVVQDERDVQSQSSSTINTLLTLLDCLADYIMERVGLEASNNGSMRNTSQDREREVDNNREPH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CXorf27.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25763
Iso type IgG

Enviar uma mensagem


CXorf27 polyclonal antibody

CXorf27 polyclonal antibody