MOSPD2 polyclonal antibody
  • MOSPD2 polyclonal antibody

MOSPD2 polyclonal antibody

Ref: AB-PAB20192
MOSPD2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MOSPD2.
Información adicional
Size 100 uL
Gene Name MOSPD2
Gene Alias MGC26706
Gene Description motile sperm domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SSKEDIESDGKETLETISNEEQTPLLKKINPTESTSKAEENEKVDSKVKAFKKPLSVFKGPLLHISPAEELYFGSTESGEKKTLIVLTNVTKNIVAFKVRTTAPEKYRVKPSNSSCDPGASVDIVVSPHGGLTVSA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MOSPD2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 158747
Iso type IgG

Enviar uma mensagem


MOSPD2 polyclonal antibody

MOSPD2 polyclonal antibody