ZNF419 polyclonal antibody
  • ZNF419 polyclonal antibody

ZNF419 polyclonal antibody

Ref: AB-PAB20188
ZNF419 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF419.
Información adicional
Size 100 uL
Gene Name ZNF419
Gene Alias FLJ23233|ZNF419A
Gene Description zinc finger protein 419
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RLLDDAQRLLYRNVMLENFTLLASLGCWHGAEAEEAPEQIASVGLLSSNIQQHQKQHCGEKPLKRQEGRVPV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF419.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79744
Iso type IgG

Enviar uma mensagem


ZNF419 polyclonal antibody

ZNF419 polyclonal antibody