ZCCHC16 polyclonal antibody
  • ZCCHC16 polyclonal antibody

ZCCHC16 polyclonal antibody

Ref: AB-PAB20187
ZCCHC16 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZCCHC16.
Información adicional
Size 100 uL
Gene Name ZCCHC16
Gene Alias FLJ46608|Mar4|Mart4
Gene Description zinc finger, CCHC domain containing 16
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QDPATFHLLAQNLICNETNQSGQFEKALADPNQDEESVTDMMDNLPDLITQCIQLDKKHSDRPELLQSETQLPLLASLIQHQALFSPTDPPPKKGPIQLREGQLPLTPAKRARQQETQLCLYCSQSGHFTRDCLAKRSRAPATTNNTAH
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZCCHC16.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 340595
Iso type IgG

Enviar uma mensagem


ZCCHC16 polyclonal antibody

ZCCHC16 polyclonal antibody