FAM117B polyclonal antibody
  • FAM117B polyclonal antibody

FAM117B polyclonal antibody

Ref: AB-PAB20183
FAM117B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM117B.
Información adicional
Size 100 uL
Gene Name FAM117B
Gene Alias ALS2CR13|DKFZp686H01244|FLJ38771
Gene Description family with sequence similarity 117, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ECSPKQLHEIPAFYCPDKNKVNFIPKSGSAFCLVSILKPLLPTPDLTLKGSGHSLTVTTGMTTTLLQPIAVASLSTNTEQDRVSRGTSTVMPSASLLPPPEPIEEAE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM117B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 150864
Iso type IgG

Enviar uma mensagem


FAM117B polyclonal antibody

FAM117B polyclonal antibody