ZNF184 polyclonal antibody
  • ZNF184 polyclonal antibody

ZNF184 polyclonal antibody

Ref: AB-PAB20181
ZNF184 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF184.
Información adicional
Size 100 uL
Gene Name ZNF184
Gene Alias -
Gene Description zinc finger protein 184
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VSKPDVISQLEQGTEPWIMEPSIPVGTCADWETRLENSVSAPEPDISEEELSPEVIVEKHKRDDSWSSNLLESWEYEGSLERQQANQQTLPKEIKVTEKTIPSWEKGPVNNEFGKSVNVSSNLVTQEPSPEETSTKRSIKQN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF184.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7738
Iso type IgG

Enviar uma mensagem


ZNF184 polyclonal antibody

ZNF184 polyclonal antibody