VAV2 polyclonal antibody
  • VAV2 polyclonal antibody

VAV2 polyclonal antibody

Ref: AB-PAB20180
VAV2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant VAV2.
Información adicional
Size 100 uL
Gene Name VAV2
Gene Alias -
Gene Description vav 2 guanine nucleotide exchange factor
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PVLTFQTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDNWI
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human VAV2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7410
Iso type IgG

Enviar uma mensagem


VAV2 polyclonal antibody

VAV2 polyclonal antibody