ZMYM3 polyclonal antibody
  • ZMYM3 polyclonal antibody

ZMYM3 polyclonal antibody

Ref: AB-PAB20178
ZMYM3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZMYM3.
Información adicional
Size 100 uL
Gene Name ZMYM3
Gene Alias DXS6673E|KIAA0385|MYM|XFIM|ZNF198L2|ZNF261
Gene Description zinc finger, MYM-type 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PEVDHGPEGTLAWDAGDQTLEPGPGGQTPEVVPPDPGAGANSCSPEGLLEPLAPDSPITLQSPHIEEEETTSIATARRGSPGQEEELPQGQPQSPNAPPSPSVGETLGDGINSSQTKPGGSSPPAHPSLPGDGLTAKASEKPPERKRS
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZMYM3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9203
Iso type IgG

Enviar uma mensagem


ZMYM3 polyclonal antibody

ZMYM3 polyclonal antibody