KTN1 polyclonal antibody
  • KTN1 polyclonal antibody

KTN1 polyclonal antibody

Ref: AB-PAB20173
KTN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KTN1.
Información adicional
Size 100 uL
Gene Name KTN1
Gene Alias CG1|KIAA0004|KNT|MGC133337|MU-RMS-40.19
Gene Description kinectin 1 (kinesin receptor)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq ETLMVPSKRQEALPLHQETKQESGSGKKKASSKKQKTENVFVDEPLIHATTYIPLMDNADSSPVVDKREVIDLLKPDQVEGIQKSGTKKLKTETDKENAEVKFKDFLLSLKTMMFSEDEALCVVDLLKEKSGVIQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KTN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3895
Iso type IgG

Enviar uma mensagem


KTN1 polyclonal antibody

KTN1 polyclonal antibody