CXorf26 polyclonal antibody
  • CXorf26 polyclonal antibody

CXorf26 polyclonal antibody

Ref: AB-PAB20172
CXorf26 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CXorf26.
Información adicional
Size 100 uL
Gene Name CXorf26
Gene Alias MGC874
Gene Description chromosome X open reading frame 26
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq EVYYKLISSVDPQFLKLTKVDDQIYSEFRKNFETLRIDVLDPEELKSESAKEKWRPFCLKFNGIVEDFNYGTLLRLDCSQGYTEENTIFAPRIQFFAIEIARNREGYNKAVYISVQDKEGEKGVNNGGEKRADSGEEENTKNGGEK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CXorf26.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51260
Iso type IgG

Enviar uma mensagem


CXorf26 polyclonal antibody

CXorf26 polyclonal antibody