ZNF443 polyclonal antibody
  • ZNF443 polyclonal antibody

ZNF443 polyclonal antibody

Ref: AB-PAB20171
ZNF443 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF443.
Información adicional
Size 100 uL
Gene Name ZNF443
Gene Alias ZK1
Gene Description zinc finger protein 443
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VALEDVAVNFTREEWALLGPCQKNLYKDVMQETIRNLDCVVMKWKDQNIEDQYRYPRKNLRCRMLERFVESKDGTQCGETSSQIQDSIVTKNTLPGVGPCESSMRGEKVMGHSSLNCYIRVGA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF443.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10224
Iso type IgG

Enviar uma mensagem


ZNF443 polyclonal antibody

ZNF443 polyclonal antibody