ZNF589 polyclonal antibody
  • ZNF589 polyclonal antibody

ZNF589 polyclonal antibody

Ref: AB-PAB20170
ZNF589 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF589.
Información adicional
Size 100 uL
Gene Name ZNF589
Gene Alias SZF1
Gene Description zinc finger protein 589
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DVAVLFTEAEWKRLSLEQRNLYKEVMLENLRNLVSLESKPEVHTCPSCPLAFGSQQFLSQDELHNHPIPGFHAGNQLHPGNPCPEDQPQSQHPSDKNHRGAEAEDQRVEGGVRPLFWSTNERGALVGFSSLFQRPPISSWGGNR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF589.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51385
Iso type IgG

Enviar uma mensagem


ZNF589 polyclonal antibody

ZNF589 polyclonal antibody