STON2 polyclonal antibody
  • STON2 polyclonal antibody

STON2 polyclonal antibody

Ref: AB-PAB20161
STON2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant STON2.
Información adicional
Size 100 uL
Gene Name STON2
Gene Alias STN2|STNB|STNB2
Gene Description stonin 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq RTPSVTEAPPWRATNPFLNETLQDVQPSPINPFSAFFEEQERRSQNSSISSTTGKSQRDSLIVIYQDAISFDDSSKTQSHSDAVEKLKQLQIDDPDHFGSATLPDDDPVAWIELDAHPPGSARSQPRDGWPMMLRIPEK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human STON2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 85439
Iso type IgG

Enviar uma mensagem


STON2 polyclonal antibody

STON2 polyclonal antibody