MDGA2 polyclonal antibody
  • MDGA2 polyclonal antibody

MDGA2 polyclonal antibody

Ref: AB-PAB20160
MDGA2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MDGA2.
Información adicional
Size 100 uL
Gene Name MDGA2
Gene Alias MAMDC1|c14_5286
Gene Description MAM domain containing glycosylphosphatidylinositol anchor 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ALVQLIVQYPPAVEPAFLEIRQGQDRSVTMSCRVLRAYPIRVLTYEWRLGNKLLRTGQFDSQEYTEYAVKSLSNENYGVYNCSIINEAGAGRCSFLVTGKAYAPEFYYDTYNPVWQNRHRVYSYSLQWTQMNPDAV
Form Liquid
Recomended Dilution Immunohistochemistry
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MDGA2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 161357
Iso type IgG

Enviar uma mensagem


MDGA2 polyclonal antibody

MDGA2 polyclonal antibody